Вес цсп 10мм: размеры, цены и характеристики материала

Содержание

Технические характеристики цементно-стружечных плит, цена и применение листов ЦСП в Москве

Номенклатура ЦСП ТАМАК

Размеры, мм Вес 1
листа*, кг
Площадь
листа, м2
Объём
листа, м3
Кол-во
листов в 1 м3
Вес
1 м3, кг
длина ширина толщина
2700 1250 8 36,45 3,375 0,0270 37,04 1300-1400
10 45,56 0,0338 29,63
12 54,68 0,0405 24,69
16 72,90
0,0540
18,52
20 91,13 0,0675 14,81
24 109,35 0,0810 12,53
36 164,03 0,1215 8,23
3200 1250 8 43,20 4,000 0,0320 31,25 1300-1400
10 54,00 0,0400 25,00
12 64,80 0,0480 20,83
16 86,40 0,0640 15,63
20 108,00 0,0800 12,50
24
129,60
0,0960 10,42
36 194,40 0,1440 6,94

* рассчитано для плотности 1350 кг/м3

Физико-механические свойства ЦСП ТАМАК

Наименование показателя,
ед. измерения
Величина показателя
1. Плотность, кг/м3 1100 — 1400
2. Влажность, % 9 ± 3
3. Разбухание по толщине за 24 ч, %, не более 1,5
4. Водопоглощение за 24 ч, %, не более 16
5. Прочность при изгибе, МПа, не менее
 
для толщины до 12 мм
для толщины от 12 до 19 мм
для толщины более 19 мм
 
6. Прочность при растяжении (перпендикулярно пласти плиты), МПа, не менее 0,5
7. Модуль упругости при изгибе, МПа, не менее 4500
8. Ударная вязкость, Дж/м2 1800
9. Группа горючести Г1
10. Морозостойкость (снижение прочности при изгибе после 50 циклов), %, не более 10
11. Шероховатость Rz по ГОСТ 7016-82, мм, не более для плит:
 
нешлифованных
шлифованных
 
12. Предельные отклонения по толщине, мм, не более для плит:
 
шлифованных  
нешлифованных толщиной: 10 мм
  12 ÷ 16 мм
  24 мм
  36 мм
 
  ± 0,3
  ± 0,6
  ± 0,8
  ± 1,0
  ± 1,4
13. Предельные отклонения по длине и ширине плит, мм: ± 3
14. Коэффициент теплопроводности, Вт/(м·К): 0,26
15. Коэффициент линейного расширения, мм/(п.м.·°C) или град-1·10-6: 0,0235 или 23,5
16. Коэффициент паропроницаемости, мг/(м·ч·Па): 0,03

Справочные показатели физико-механических свойств ЦСП ТАМАК

Наименование показателя,
ед. измерения
Значение для плит ЦСП-1 ГОСТ
1 Модуль упругости при изгибе, МПа, не менее 4500 ГОСТ 10635-88
2 Твёрдость, МПа 46-65 ГОСТ 11843-76
3 Ударная вязкость, Дж/м2, не менее 1800 ГОСТ 11843-76
4 Удельное сопротивление выдёргиванию шурупов из пластин, Н/м 4-7 ГОСТ 10637-78
5 Удельная теплоёмкость, кДж/(кг·K) 1,15
6 Класс биостойкости
4
ГОСТ 17612-89
8 Снижение прочности при изгибе (после 20 циклов температурно-влажностных воздействий), %, не более 30
9 Разбухание по толщине (после 20 циклов температурно-влажностных воздействий), %, не более 5
10 Горючесть Группа слабогорючих Г1 ГОСТ 30244-94
11 Морозостойкость (снижение прочности при изгибе после 50 циклов), %, не более 10 ГОСТ 8747-88

Таблица нагрузки на ЦСП Тамак «Сосредоточенная нагрузка — однопролётная балка»

Пролёт,
мм
Нагрузка, кН
Толщина
8 мм
Толщина
10 мм
Толщина
12 мм
Толщина
16 мм
Толщина
20 мм
Толщина
24 мм
200 0,279 0,416 0,572 0,956 1,489 1,997
250 0,223 0,333 0,457 0,765 1,191 1,597
300 0,186 0,278 0,381 0,637 0,993 1,331
350 0,159 0,238 0,327 0,546 0,851 1,141
400 0,139 0,208 0,286 0,478 0,744 0,998
450 0,124 0,185 0,254 0,425 0,662 0,887
500 0,111 0,167 0,229 0,382 0,596 0,799
550 0,101 0,151 0,208 0,348 0,541 0,726
600 0,093 0,139 0,191 0,319 0,496 0,666

Теплотехнические свойства

ЦСП, благодаря органическому соединению древесины и цемента, представляют собой однородный монолитный материал без воздушных вкраплений, что обеспечивает высокую теплопроводность. Поэтому наибольшее применение ЦСП находят в конструкциях, где требуется сочетание высокой прочности и низкого температурного сопротивления материала. Теплотехнические свойства ЦСП оцениваются с помощью коэффициента теплопроводности, который является важнейшим теплотехническим показателем строительных материалов.

Зависимость коэффициента теплопроводности от толщины плиты

Толщина плит, мм Теплопроводность, Вт/м·°C Температурное сопротивление, м2·°C/Вт
8 0,26 0,031
10 0,035
12 0,046
16 0,062
20 0,077
24 0,092
36 0,138

Звукоизоляция

Индекс изоляции воздушного шума

ЦСП ТАМАК 10 мм RW=30 дБ
ЦСП ТАМАК 12 мм RW=31 дБ

Индекс изоляции ударного шума

Цементно-стружечные плиты толщиной 20 и 24 мм, уложенные непосредственно на железобетонное несущее перекрытие измерительной камеры НИИСФ РААСН, обеспечивают улучшение изоляции ударного шума на 16-17 дБ соответственно.

При укладывании цементно-стружечных плит толщиной 20 и 24 мм не непосредственно на железобетонную плиту перекрытия, а на промежуточный слой упруго мягкого материала происходит дополнительно улучшение изоляции ударного шума, составляющее 9-10 дБ.

Удельное сопротивление выдёргиванию шурупов

Наименование
шурупа,
DxL, мм
Диаметр отверстия
под шуруп, мм
Среднее удельное
сопротивление из
5 испытаний, Н/мм
Разброс удельного
сопротивления,
Н/мм
1 5,5 х 30 3,0 122 118 ÷ 137
2 5,0 х 30 3,0 85 68 ÷ 103
3 4,5 х 30 3,0 93 80 ÷ 108
4 4,0 х 30
(L резьбы 20 мм)
2,5 110 88 ÷ 147
5 4,0 х 30
(L резьбы полная)
2,5 114 103 ÷ 124
6 3,5 х 30 2,5 104 87 ÷ 116
      ср. 105  

 

Цементно-стружечная плита ЦСП Тамак 10мм 2700*1250мм Поставщик№ 179 Кирпичные выемки

Цементно-стружечные плиты Тамак — это монолитные плиты плотностью 1250-1400кг/м3, толщиной 8-36 мм с гладкой или твердой поверхностью, применяемые в технологии “сухого монтажа”.

Качество ЦСП обеспечивается строгим контролем качества в соответствии с ГОСТ 26816-86 (ЦСП-1 высшее качество) и европейским стандартом EN 634-2.

ЦСП – это экологически чистый материал. В ЦСП не содержится фенольных, формальдегидных и других ядовитых соединений. Основным химическим вяжущим является цемент.

Плиты изготавливаются путем прессования отформованной смеси, состоящей из стружки древесины хвойных пород, портландцемента, минеральных веществ и воды. В процессе производства стружечно-цементный ковер формируется из четырех слоев: наружные слои — из мелких фракций стружки, внутренние — из более крупных фракций стружки.

При пожарах в помещениях плиты не образуют дыма, не выделяют токсичных газов и паров. Испытание на огнестойкость конструкций вентфасадов с облицовкой ЦСП 8мм (класс К0, ГОСТ 31251-2003). 45 мин.

ЦСП противостоит воздействию грибков, жуков – древоточцев, домашних грызунов. Антисептик образуется в массе самой ЦСП в процессе превращения цемента в бетон, так как побочным продуктом этого процесса является гидроксид кальция, создающий сильнощелочную среду, препятствующую развитию плесневых грибков.

Технические характеристики:

— модуль упругости при изгибе, МПа, не менее: 3500

— твёрдость, Мпа: 46-65

-ударная вязкость, Дж/м, не менее: 2400

— удельное сопротивление выдёргиванию шурупов из пластин, Н/м: 4-7

— удельная теплоёмкость, кДж/(кг·K): 1,15

— класс биостойкости: 4

-снижение прочности при изгибе (после 20 циклов температурно-влажностных воздействий), %, не более: 30

— разбухание по толщине (после 20 циклов температурно-влажностных воздействий), %, не более: 5

— горючесть Группа слабогорючих: Г1

— морозостойкость (снижение прочности при изгибе после 50 циклов), %, не более: 10

Зависимость коэффициента теплопроводности от толщины плиты:

8мм — 0,031 м2·°C/Вт

10мм — 0,035 м2·°C/Вт

12мм — 0,046 м2·°C/Вт

16мм — 0,062 м2·°C/Вт

20мм — 0,077 м2·°C/Вт

24мм — 0,092 м2·°C/Вт

36мм — 0,138 м2·°C/Вт

Звукоизоляция:

ЦСП 10 мм RW=30 дБ

ЦСП 12 мм RW=31 дБ

Индекс изоляции ударного шума:

Цементно-стружечные плиты толщиной 20 и 24 мм, уложенные непосредственно на железобетонное несущее перекрытие измерительной камеры НИИСФ РААСН, обеспечивают улучшение изоляции ударного шума на 16-17 дБ соответственно.

При укладывании цементно-стружечных плит толщиной 20 и 24 мм не непосредственно на железобетонную плиту перекрытия, а на промежуточный слой упруго мягкого материала происходит дополнительно улучшение изоляции ударного шума, составляющее 9-10 дБ.

1. На время распутицы вводится временное ограничение движения транспортных средств с грузом, следующим по автомобильным дорогам общего пользования (закрытие дорог в связи с весенним паводком)

В период временного ограничения действуют следующие допустимые нагрузки:

  • 5-ти осное ТС 25т — нагрузка 13 тонн,
  • 4-х осное ТС 20т — нагрузка 8 тонн,
  • 3-х осное ТС 10т — нагрузка 4 тонны.

2. Въезд в пределы МОЖД (Московская окружная железная дорога) транспортного средства грузоподъемностью свыше 3,5 тонн по согласованию.

3. Въезд в пределы ТТК (Третье транспортное кольцо) транспортного средства грузоподъемностью свыше 1 тонны по согласованию.

4. Въезд на МКАД транспортного средства грузоподъемностью свыше 10 тонн по согласованию.

5. Время доставки заказа в течение дня:

  • с 8.00 до 22.00 в период с апреля по сентябрь
  • с 8.00 до 19.00 в период с октября по март

6. В случае поставки заказа большим или меньшим количеством автомашин перерасчет заказа не производится.

7. Покупатель обязан обеспечить наличие подъезда от автомобильных дорог общего пользования с асфальтобетонным покрытием к месту разгрузки (твердое покрытие, ширина дороги не менее 3 метров, радиус разворота не менее 15 метров) с отсутствием по маршруту подъезда к месту разгрузки дорожных знаков, запрещающих движение данному виду транспорта, в противном случае оплатить все дополнительные расходы, возникшие из-за невыполнения данных условий по расценкам Поставщика.

8. Покупатель обязан обеспечить место для разгрузки Товара, позволяющее беспрепятственно и быстро осуществить разгрузку. Покупатель обязан обеспечить строповку (обвязку) Товара для производства разгрузочных работ, в том числе манипулятором. Если разгрузка Товара осуществляется силами Поставщика, а Покупатель просит выгрузить Товар через какие-либо препятствующие разгрузочным работам объекты (заборы, ограды, столбы освещения, ЛЭП, деревья и прочее), затраты, связанные с повреждением и восстановлением указанных обектов, полностью ложатся на Покупателя.

9. Покупатель обязан обеспечить разгрузку транспортного средства грузоподъемностью 1,5 — 5 тонн в течение 1 часа, свыше 5 тонн — в течение 2 часов.

10. В случае простоя транспортного средства с товаром в месте выгрузки свыше времени, указанного в п.9 Покупатель обязан оплатить водителю простой в размере 1000 р. за каждый последующий час.

11. Приемка Товара по количеству, ассортименту и качеству (внешнему виду) осуществляется во время передачи Товара Покупателю или его уполномоченному представителю. При обнаружении недостатков Товара во время его приемки Покупатель обязан приостановить разгрузку и немедленно известить Поставщика о выявленных дефектах. В одностороннем порядке составить акт с указанием подробного перечня выявленных дефектов и отметить это в товарной накладной. После приемки и подписания документов на Товар Покупатель лишается права в дальнейшем предъявлять претензии Поставщику по количеству, ассортименту и качеству Товара.

12. В случае не предоставления доверенностей на уполномоченное лицо выгрузка Товара не производится.

13. Поставщик не принимает претензии по качеству при неправильной разгрузке заказа (сбрасыванием).

14. При отказе Покупателем от заказа после его оплаты Покупатель возмещает Поставщику расходы, понесенные в связи с совершением действий по выполнению Договора.

15. При оплате Заказа на условиях предоплаты (менее 100%) Покупатель обязан произвести окончательный расчет до момента поставки.

Как узнать вес строительных материалов

Наименование

Ед.изм.

Вес, кг

ДВП 1,22*2,75 3,2мм

Лист

8,7

ДВП 1,70*2,75 3,2мм

Лист

12,0

ДСП 1,83*2,50 16мм

Лист

45,0

ДСП 1,70*3,50 16мм

Лист

61,0

ВДСПШ Quickdeck 1830*600 12мм

Лист

9,5

ВДСПШ Quickdeck 2440*900 12мм

Лист

19

ВДСПШ Quickdeck 2440*600 16мм

Лист

16,9

ВДСПШ Quickdeck 2440*600 22мм

Лист

23,2

Плита OSB-3 1250*2500 9мм

Лист

18,6

Плита OSB-3 1250*2500 12мм

Лист

23,8

Плита OSB-3 1250*2500 15мм

Лист

30,0

Плита OSB-3 1250*2500 18мм

Лист

34,6

Плита OSB-3 1250*2500 20мм

Лист

40,0

ЦСП 1250*3200 10мм

Лист

50

ЦСП 1250*3200 12мм

Лист

60

ЦСП 1250*3200 16мм

Лист

80

ЦСП 1250*3200 20мм

Лист

100

Фанера ФК 1525*1525 4мм

Лист

6,5

Фанера ФК 1525*1525 6мм

Лист

9,5

Фанера ФК 1525*1525 8мм

Лист

12,5

Фанера ФК 1525*1525 10мм

Лист

15,5

Фанера ФК 1525*1525 12мм

Лист

19,0

Фанера ФК 1525*1525 15мм

Лист

23,5

Фанера ФК 1525*1525 18мм

Лист

28,0

Фанера ФК 1525*1525 20мм

Лист

31,0

Фанера ФСФ 1220*2440 6,5мм

Лист

13,0

Фанера ФСФ 1220*2440 9мм

Лист

18,0

Фанера ФСФ 1220*2440 12мм

Лист

24,0

Фанера ФСФ 1220*2440 15мм

Лист

30,0

Фанера ФСФ 1220*2440 18мм

Лист

36,0

ГКЛ 1200*2500 9,5мм

Лист

20,1

ГКЛ 1200*2500 12,5мм

Лист

27,6

ГКЛВ 1200*2500 9,5мм

Лист

23,4

ГКЛВ 1200*2500 12,5мм

Лист

30,6

Стеклоизол К-3,5 ст/холст 1*10м

Рул.

35

Стеклоизол К-4,0 ст/ткань 1*10м

Рул.

40

Стеклоизол П-2,5 ст/ткань 1*10м

Рул.

25

Стеклоизол П-2,5 ст/холст 1*10м

Рул.

25

Стеклокром К-4,5 ст/ткань 1*10м

Рул.

45

Рубероид РКК-350 10м

Рул.

27

Рубероид РКП-350(о) 15м

Рул.

21

Шифер 7-волн 1750*950 8 мм

Лист

23

Шифер плоский 1750*1100 8мм

Лист

31,5

Труба хризотилцементная д.100мм 3,95м

Шт.

26,5

Труба хризотилцементная д.150мм 3,95м

Шт.

38

Кирпич красный М-100, М-125

Шт.

3,5

Профнастил оцинкованный С-10 1180*2000

Шт.

9,6

Профнастил окрашенный С-10 1180*2000

Шт.

10,0

Плита ИЗОРОК ПП-60 1000*500*50(100)мм 0,2м3

Упак.

12,0

Плита мин. Изолайт 50пл 1000*500*50 0,2м3

Упак.

10,0

Плита мин. Изорок П-125 1000*500*50(100)мм 0,2м3

Упак.

20,0

Плиты теплоизоляционные из мин. ваты ECOROCK 1200*600*50 (8шт-5,76м2)

Упак.

10,0

ISOVER Каркас-М40 (50*1220*9000) 21,96м2-1,098м3

Упак.

16,5

Цементно-стружечная плита 10 мм | ТДВ

ЦСП 10 мм – плоский спрессованный листовой материал, сформованный из древесных стружек и цементного связующего. Прочный, легкий, устойчивый к влаге и перепадам температур – это один из лучших вариантов облицовки капитальных стен изнутри и снаружи.

Особенности

Плита ЦСП 10 мм, благодаря особой структуре расположения фракций стружек в массиве – внутри крупные, снаружи мелкие, упруга и прочна, как плита ДСП, однако абсолютно безопасна для человека и животных. Ведь цементное связующее не выделяет в атмосферу летучих соединений фенола.

Цемент делает ее непроницаемой для воды и устойчивой к многократному переходу от минусовых к плюсовым температурам. При полном и длительном погружении в воду количество набранной воды не превышает 16% от всего объема, линейные размеры увеличиваются не более чем на 1,5 процента. После пятидесяти циклов замерзания-размораживания ее остаточная прочность не ниже 90%, видимые повреждения – трещины, расслоения – отсутствуют. При формовании листа используется хлорид кальция, предотвращающий развитие плесневых грибков внутри него.

Лист ЦСП 10 мм имеет значительно меньший удельный вес, чем асбоцементные плиты того же типоразмера: при стандартной длине 3200 и ширине 1200 мм он весит не более пятидесяти килограммов. Такой эффект достигнут за счет того, что древесно-стружечный наполнитель даже при продолжительном прессовании – длительность технологического процесса формования достигает восьми часов, остается относительно рыхлым. Наличие микроскопических пор позволяет ему удерживать тепло и делает материал паропроницаемым, пригодным для наружной отделки капитальных стен с применением минераловатных плит.

По пожарной классификации относится к группе Г1 – трудногорючий. Не способен к самовоспламенению, не распространяет пламя, выделяет мало дыма. В состав газов, выделяющихся при нагревании, токсичные вещества не входят!

Обладает отличной адгезией ко всем видам лаков и красок, штукатурке, шпаклевке на основе акрила, не разрушается растворами, содержащими кислоты или щелочи. Легко режется, сверлится ручным инструментом.

Применение

Тонкие листы цементно-стружечных плит в большей степени подходят для облицовочных работ. Абсолютная экологическая чистота позволяет применять их внутри помещений, к которым предъявляются особые требования по безопасности. Стойкость к атмосферным коллизиям – перепадам температур, влажности, и паропроницаемость делают их пригодными для облицовки внешних стен зданий по технологии вентилируемого фасада. Кроме того, ее можно применять:

  • Для устройства несъемной опалубки.
  • Черновых оснований, в том числе для системы отопления «Теплый пол» и сухой стяжки по бетонным перекрытиям.
  • Устройства сплошной обрешетки при кровельных работах с углом ската не менее 35°.
  • Производства сэндвич-панелей.

Цена ЦСП 10 мм полностью оправдывает себя при проведении отделочных работ. Она с успехом заменяет штукатурку – не уступает ей по прочности, а монтировать ее гораздо проще и быстрее: не требуется времени на подготовку раствора и ожидание его отверждения, рабочие могут не обладать специальными навыками.

В нашем интернет-магазине вы можете купить ЦСП 10 мм партиями любого объема. А также заказать их доставку в любой населенный пункт Ленинградской области или район Санкт-Петербурга в удобное для вас время.

Вес: 54,8 кг
В пачке: 28 листов


ЦСП размеры листа и цена толщина вес

ЦСП – цементно-стружечная плита, которая широко используется в строительстве домов, для их утепления, внутренней отделки, смены полов, наружных работ, закладки фундаментов и даже для грядок. Другими словами, практически в каждом направлении может быть использована.

Качественные ЦСП полосы , изготовленные по всем нормам, купить вы сможете из нашего каталога, где в ассортименте всегда большой выбор стройматериалов в Нижнем Новгороде.

ЦСП для внутренней отделки >>>>>> ПЕРЕЙТИ В РАЗДЕЛ

ЦСП для наружной отделки >>>>>> ПЕРЕЙТИ В РАЗДЕЛ

ЦСП для кровли >>>>>> ПЕРЕЙТИ В РАЗДЕЛ

ЦСП для стен >>>>>> ПЕРЕЙТИ В РАЗДЕЛ

ЦСП для цоколя >>>>>> ПЕРЕЙТИ В РАЗДЕЛ

ЦСП плиты водостойкие >>>>>> ПЕРЕЙТИ В РАЗДЕЛ

ЦСП для фасада >>>>>> ПЕРЕЙТИ В РАЗДЕЛ

 /   /   /   /   /   /   /   /   /   /   / 

Все товары

Купить ЦСП в Нижнем Новгороде

Такая плита изготовлена из стружки дерева, портландцемента и минеральных добавок. Этот материал имеет высокую прочность и устойчив к влаге, долговечен, обладает безупречной шумоизоляцией и теплоизоляцией. Также ЦСП стойкая к грибкам и плесени. Обрабатывать плиты можно штукатуркой, облицовкой из пластика, керамики, лакокрасочными средствами. Очень стойкий стройматериал к огню, холоду и теплу. Грызуны и насекомые не повреждают, так в составе имеется стружка и цемент, но вредных примесей нет, таких как асбест, формальдегид и др.

 

Заслужено плиту считают универсальным строительным материалом, так как она может использоваться как для внутренних работ, так и для наружных в любых климатических условиях.

Производство данного стройматериала выполнено по всем требованиям ГОСТа, также существует паспорт ОТК и сертификат качества продукции.

Цены на стройматериал «ЦСП»

Показать ещё цены на стройматериал «ЦСП»

ЦСП 3200*1200*10 мм

Общие положения

Некоторые объекты, размещенные на сайте, являются интеллектуальной собственностью компании «Фанера 003.RU — купить фанеру, МДФ, ЛДСП, ДСП оптом и в розницу». Использование таких объектов установлено действующим законодательством РФ.

На сайте «Фанера 003.RU — купить фанеру, МДФ, ЛДСП, ДСП оптом и в розницу» имеются ссылки, позволяющие перейти на другие сайты. Компания «Фанера 003.RU — купить фанеру, МДФ, ЛДСП, ДСП оптом и в розницу» не несет ответственности за сведения, публикуемые на этих сайтах и предоставляет ссылки на них только в целях обеспечения удобства для посетителей своего сайта.

Личные сведения и безопасность

Компания «Фанера 003.RU — купить фанеру, МДФ, ЛДСП, ДСП оптом и в розницу» гарантирует, что никакая полученная от Вас информация никогда и ни при каких условиях не будет предоставлена третьим лицам, за исключением случаев, предусмотренных действующим законодательством Российской Федерации.

В определенных обстоятельствах компания «Фанера 003.RU — купить фанеру, МДФ, ЛДСП, ДСП оптом и в розницу» может попросить Вас зарегистрироваться и предоставить личные сведения. Предоставленная информация используется исключительно в служебных целях, а также для предоставления доступа к специальной информации.

Личные сведения можно изменить, обновить или удалить в любое время в разделе «Аккаунт» > «Профиль».

Чтобы обеспечить Вас информацией определенного рода, компания «Фанера 003.RU — купить фанеру, МДФ, ЛДСП, ДСП оптом и в розницу» с Вашего явного согласия может присылать на указанный при регистрации адрес электронный почты информационные сообщения. В любой момент Вы можете изменить тематику такой рассылки или отказаться от нее.

Как и многие другие сайты, «Фанера 003.RU — купить фанеру, МДФ, ЛДСП, ДСП оптом и в розницу» использует технологию cookie, которая может быть использована для продвижения нашего продукта и измерения эффективности рекламы. Кроме того, с помощь этой технологии «Фанера 003.RU — купить фанеру, МДФ, ЛДСП, ДСП оптом и в розницу» настраивается на работу лично с Вами. В частности без этой технологии невозможна работа с авторизацией в панели управления.

Сведения на данном сайте имеют чисто информативный характер, в них могут быть внесены любые изменения без какого-либо предварительного уведомления.

Чтобы отказаться от дальнейших коммуникаций с нашей компанией, изменить или удалить свою личную информацию, напишите нам через форму обратной связи

Товар не найден

Общие положения

Некоторые объекты, размещенные на сайте, являются интеллектуальной собственностью компании «Фанера 003.RU — купить фанеру, МДФ, ЛДСП, ДСП оптом и в розницу». Использование таких объектов установлено действующим законодательством РФ.

На сайте «Фанера 003.RU — купить фанеру, МДФ, ЛДСП, ДСП оптом и в розницу» имеются ссылки, позволяющие перейти на другие сайты. Компания «Фанера 003.RU — купить фанеру, МДФ, ЛДСП, ДСП оптом и в розницу» не несет ответственности за сведения, публикуемые на этих сайтах и предоставляет ссылки на них только в целях обеспечения удобства для посетителей своего сайта.

Личные сведения и безопасность

Компания «Фанера 003.RU — купить фанеру, МДФ, ЛДСП, ДСП оптом и в розницу» гарантирует, что никакая полученная от Вас информация никогда и ни при каких условиях не будет предоставлена третьим лицам, за исключением случаев, предусмотренных действующим законодательством Российской Федерации.

В определенных обстоятельствах компания «Фанера 003.RU — купить фанеру, МДФ, ЛДСП, ДСП оптом и в розницу» может попросить Вас зарегистрироваться и предоставить личные сведения. Предоставленная информация используется исключительно в служебных целях, а также для предоставления доступа к специальной информации.

Личные сведения можно изменить, обновить или удалить в любое время в разделе «Аккаунт» > «Профиль».

Чтобы обеспечить Вас информацией определенного рода, компания «Фанера 003.RU — купить фанеру, МДФ, ЛДСП, ДСП оптом и в розницу» с Вашего явного согласия может присылать на указанный при регистрации адрес электронный почты информационные сообщения. В любой момент Вы можете изменить тематику такой рассылки или отказаться от нее.

Как и многие другие сайты, «Фанера 003.RU — купить фанеру, МДФ, ЛДСП, ДСП оптом и в розницу» использует технологию cookie, которая может быть использована для продвижения нашего продукта и измерения эффективности рекламы. Кроме того, с помощь этой технологии «Фанера 003.RU — купить фанеру, МДФ, ЛДСП, ДСП оптом и в розницу» настраивается на работу лично с Вами. В частности без этой технологии невозможна работа с авторизацией в панели управления.

Сведения на данном сайте имеют чисто информативный характер, в них могут быть внесены любые изменения без какого-либо предварительного уведомления.

Чтобы отказаться от дальнейших коммуникаций с нашей компанией, изменить или удалить свою личную информацию, напишите нам через форму обратной связи

Рекомбинантный белковый антиген CSP (NBP1-87975PEP): Novus Biologicals

Резюме по антигену рекомбинантного белка CSP

Описание Рекомбинантный белковый антиген с N-концевой меткой His6-ABP, соответствующей ДНК человека JC5.

Источник: E.coli

Аминокислотная последовательность: MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDAT

Источник

E.кишечная палочка

Тип белка / пептида

Рекомбинантный белковый антиген

Джин

DNAJC5

Чистота

> 80% по данным SDS-PAGE и окрашиванию Кумасси синим

Применения / разбавления

Разведения
  • Конкуренция антител 10-100 молярный избыток
Примечания по применению Этот пептид полезен в качестве пептида, блокирующего NBP1-87975.Белок очищали хроматографией на IMAC. Ожидаемая концентрация больше 0,5 мг / мл. Этот продукт производится по запросу, ориентировочная дата доставки — 4 недели после размещения заказа.Для дальнейшей блокировки информации, связанной с пептидами, и протокола щелкните здесь.
Теоретическая МВт

26 кДа.
Примечание об отказе от ответственности: наблюдаемая молекулярная масса белка может отличаться от указанной в списке прогнозируемой молекулярной массы из-за посттрансляционных модификаций, посттрансляционных расщеплений, относительных зарядов и других экспериментальных факторов.

Упаковка, хранение и составы

Хранение

Хранить при -20 ° C. Избегайте циклов замораживания-оттаивания.

Буфер

PBS и 1M мочевина, pH 7,4.

Консервант

Без консерванта

Чистота

> 80% по данным SDS-PAGE и окрашиванию Кумасси синим

Банкноты

Этот продукт предназначен для использования в качестве блокирующего антигена в тестах на конкуренцию антител.Любое другое использование этого антигена связано с риском для пользователя. Использование этого продукта в коммерческих целях строго запрещено. Если у вас возникнут вопросы, обратитесь в службу технической поддержки.

Альтернативные названия для антигена рекомбинантного белка CSP

  • CSP
  • протеин цепочки цистеина альфа
  • Белок цепи цистеина
  • DKFZp434N1429
  • DKFZp761N1221
  • Гомолог DnaJ (Hsp40), подсемейство C, член 5
  • dnaJ гомолог
  • dnaJ, гомолог
  • FLJ, подсемейство C, член C , FLJ 900J

Ограничения

Этот продукт предназначен только для исследовательского использования и не одобрен для использования на людях или для клинической диагностики.Гарантия на пептиды и белки составляет 3 месяца с даты получения.

Покупатели, которые просматривали этот товар, также просматривали …

Виды: Hu

Применения: WB, ICC / IF, IHC, IHC-P, KD

Виды: Hu, Mu

Применения: WB, ICC / IF, IHC, IHC-P

Виды: Hu

Применения: WB, Flow, ICC / IF, IHC, IHC-P, Flow-IC

Виды: Hu, Mu, Rt

Применения: WB, Simple Western, Flow, ICC / IF, IHC, IHC-P, IM, IP

Породы: Hu, Mu

Применения: WB, IHC, IP

Виды: Hu, Mu, Rt, Pm, Pm

Применения: WB, Flow, ICC / IF, IHC, CyTOF-ready

Породы: Hu

Применения: WB

Виды: Hu, Mu, Rt

Применения: WB, IHC, IHC-P

Виды: Mu

Применения: WB, IHC, IP, ICC

Виды: Hu, Mu, Rt, Ze

Применения: WB, ICC / IF, IHC, IHC-P

Виды: Hu, Mu

Применения: WB, Simple Western, ChIP, IHC, IHC-P, KD

Виды: Hu, Mu, Rt, Bv, Fe, Fi, Ha, Pm

Применения: WB, Flow, IB, ICC / IF, IHC, IHC-Fr, IHC-P, IP, B / №

Виды: Hu, Mu

Применения: WB, IHC, IHC-P

Породы: Hu, Mu, Rt

Применения: WB, ICC / IF, IHC, IHC-P, IP

Породы: Hu

Применения: AC

Публикации по белку CSP (NBP1-87975PEP) (0)

Нет публикаций по белку CSP (NBP1-87975PEP).

Отправляя информацию о публикации, зарабатывайте подарочные карты и скидки для будущих покупок.

Обзоры протеина CSP (NBP1-87975PEP) (0)

Нет обзоров для CSP Protein (NBP1-87975PEP). Отправив отзыв, вы получите электронную подарочную карту Amazon или скидку на продукцию Novus.
  • Обзор без изображения — 10 долларов / 7 евро / 6 фунтов стерлингов / 10 канадских долларов / 70 юаней / 1110 йен
  • Обзор с изображением — 25 долларов / 18 евро / 15 фунтов стерлингов / 25 канадских долларов / 150 юаней / 2500 йен

Часто задаваемые вопросы по белку CSP (NBP1-87975PEP) (0)

Другие доступные форматы

Дополнительные продукты CSP

Инструмент биоинформатики для белка CSP (NBP1-87975PEP)

Откройте для себя пути, заболевания и гены, связанные с белком CSP (NBP1-87975PEP).Нужна помощь? Прочтите Руководство по использованию инструмента биоинформатики для получения инструкций по использованию этого инструмента.

Блоги на CSP

Amkor Technology провела квалификацию четырех новых изделий из тонких стеклопакетов толщиной 1,0 мм; Расширяет самое широкое в отрасли семейство 3D-упаковок

ЧАНДЛЕР, Аризона, 9 мая 2002 г. (БИЗНЕС-ПРОВОД) — Amkor Technology Inc. (Nasdaq: AMKR) объявила сегодня, что она первая квалифицируется на семью из двух человек. Пакетные пакеты масштабирования микросхем (S-CSP) для соответствия 1.Требования к низкому профилю 0 мм для уменьшение размера и веса беспроводных телефонов нового поколения. Четыре новых Продукты S-CSP позволяют комбинировать широкий спектр комбинаций, в том числе устройства, которые имеют такой же или аналогичный размер матрицы, за счет использования низкопрофильного технологии соединения проволоки, тонкой матрицы, крепления тонкой матрицы и тонких прокладок. Квалифицированный Технологии подложек включают либо жесткие, либо гибкие тонкослойные ленты подложки, чтобы обеспечить широкий диапазон плотностей межсоединений, необходимых для стеки памяти или возникающая логика плюс стек устройств памяти.

«Квалификация Амкора в отношении этого нового семейства CSP с 1,0-миллиметровым стеком весьма значительна. потому что он хорошо сочетается с переходом на конденсаторы высотой 1,0 мм. Это позволяет для большей гибкости дизайна для интеграции большего количества функций и функций без жертвуя нашими планами по уменьшению размеров «, — сказал Ясунори Танака, менеджер Инжиниринг для подразделения разработки мобильных терминалов NEC.

«Амкор» разработал самое обширное в отрасли семейство продуктов для трехмерной упаковки. после двухэтапной разработки технологии / продукта и аттестации стратегия.На первом этапе реализовано постоянное улучшение основных Платформенные материалы и технологические процессы, в том числе усовершенствованное утонение пластин через обработку; пленка или паста прикрепляют матрицу; узел тонкой проставки для того же размера штабелирование штампов; низкая петля и стежок стежка для склеивания проволоки; и высокая производительность Бессвинцовые и экологически чистые материалы на передовых технологиях изготовления субстратов. Второй Фаза применила эти технологии 3D-платформы в широком круге выводов Амкора и Портфолио полупроводниковой упаковки на основе ламината для удовлетворения широкого спектра приложений и различных комбинаций устройств, которые обеспечивают более высокий уровень кремниевый КПД.

Тед Тессье, вице-президент Группы передовых приложений Амкор, заявил: возможности, квалифицированные в этом новом семействе 1.0mm Stack CSP, в сочетании с нашими приверженность агрессивной реализации нашей стратегии трехмерной упаковки позволила Амкору для доставки клиенту образцов для пакета CSP с 4 кристаллами 1,0 мм и толщиной 75 микрон умереть. Кроме того, недавно мы получили значительную победу в дизайне, чтобы разработать и квалифицировать CSP стека с 3 кристаллами высокой плотности для приложений логики + памяти. Наш возможности для 3D-решений как для кристаллов, так и для укладки пакетов стремительно растут по мере того, как промышленность использует преимущества 3D-упаковки для системы и кремниевая интеграция.»

 Информация об Амкоре:
 
Амкор — крупнейший в мире поставщик контрактной сборки и сборки микроэлектроники. тестовые услуги. Компания предлагает производителям полупроводников и электроники полный комплекс услуг по проектированию и производству микроэлектроники. Более информация об Амкоре доступна из документов компании в SEC и на сайте Амкора. сайт: www.amkor.com.
 КОНТАКТЫ: Amkor Technology Inc., Chandler
                  Джеффри Лют
                  Вице-президент по корпоративным коммуникациям
                  480 / 821-2408 доб.5130
                  Патрик МакКинни
                  Старший вице-президент по корпоративному маркетингу
                  480 / 821-2408 доб. 5179

URL: http://www.businesswire.com
Сегодняшние новости в сети - полный файл Business Wire в Интернете
с гиперссылками на вашу домашнюю страницу.
 
 Copyright (C) 2002 Business Wire. Все права защищены.
 

В поисках лучшего теплового решения для конструкций модулей CSP — профессиональные светодиоды

Светодиоды CSP, последнее воплощение перевернутых светодиодов, начали свою жизнь в качестве подсветки для телевизоров.В этих приложениях без проблем использовались светодиоды малой и средней мощности. По мере того как рынок неумолимо движется в сторону общего освещения, номинальная мощность CSP растет. CSP для общего освещения относятся к категории «высокомощных» (более 1 Вт), и с доступными в настоящее время устройствами мощностью до 3 Вт это вызывает проблемы.

Термин «корпус в масштабе чипа» определяется как размер корпуса не более чем на 20% больше, чем сам чип (следующим шагом является упаковка на уровне пластины, где размер упаковки равен размеру чипа).Для этого производители светодиодов удаляют как можно больше лишних элементов. Возьмите стандартный мощный светодиод в корпусе и удалите керамическую опору и провода, непосредственно металлизируйте контакты P и N и покройте люминофором, и вы получите светодиод CSP. Этот метод отлично подходит для производителей светодиодов, поскольку он снижает затраты на материалы и производство. Это также приводит к очень маленькому (часто 1×1 мм) корпусу светодиода, который можно плотно упаковать в модули печатной платы, помогая создавать меньшие, более яркие и дешевые светильники.

Благодаря этим преимуществам рынок CSP демонстрирует уверенный рост. По оценке отраслевого аналитика Yole Développement, к 2020 году CSP будут составлять 34% рынка мощных светодиодов.

Почему операторы связи представляют такую ​​тепловую проблему

Однако у CSP есть свои проблемы. Небольшие размеры могут создавать проблемы при работе с машинами для подбора и укладки. Отсутствие линзы означает, что необходимо тщательно продумать управление лучом. Но наиболее непосредственной является тепловая проблема, связанная с переходом на все более мощные CSP.

CSP

предназначены для пайки непосредственно на печатную плату с использованием их металлизированных контактов P и N. Это снижает тепловое сопротивление между кристаллом светодиода и печатной платой, что, с одной точки зрения, является положительным моментом. Однако отсутствие керамической подставки, которая действует как теплораспределитель между кристаллом и платой в традиционных корпусных светодиодах, означает передачу тепла от кристалла к печатной плате в качестве интенсивного точечного источника тепла. Проблема управления температурным режимом фактически сместилась с «Уровня 1» (уровень упаковки светодиодных кристаллов) на «Уровень 2» (уровень модуля).Это означает, что проектировщики модулей и светильников должны быть предельно осторожны, чтобы обеспечить надлежащее охлаждение светодиодов CSP. Для удовлетворения этих требований используются печатные платы с металлической оболочкой (MCPCB) с алюминиевым или медным основанием.

Чтобы проиллюстрировать это, давайте рассмотрим пример светодиода с соединением проводов размером 1х1 мм, прикрепленного к стандартной вспомогательной опоре «Level One», изготовленной из нитрида алюминия, имеющей длину стороны 3,5 мм и толщину 0,635 мм. В этом случае размер источника тепла составляет 1 мм2, и если предположить, что теплопроводность нитрида алюминия изотропна, простая тепловая модель показывает, что тепло распространяется на площадь примерно 5 мм2.Очевидно, что большая часть тепла остается сосредоточенной в центральной области, но даже в этом случае эффект субмаунта заключается в значительном уменьшении плотности теплового потока, прежде чем он достигнет модуля MCPCB. Для светодиода CSP действует обратное. Опять же, если взять устройство 1×1 мм, паяльные площадки должны быть меньше этого и могут иметь размер только 0,3×0,8 мм каждая. Это уменьшает начальную площадь, доступную для переноса тепла, примерно наполовину, поэтому к тому времени, когда она достигает холодной стороны субмаунта, происходит меньшее распространение тепла.Это соответствует двукратной разнице в охлаждающей способности светодиода CSP и светодиода с соединением проводов на вспомогательной установке.

Цена неспособности эффективно отвести это тепло может заключаться в сокращении срока службы, плохом качестве света, флуктуациях цвета и, в конечном итоге, катастрофическом выходе из строя светодиода.

В отсутствие дополнительного крепления для светодиодов CSP только MCPCB должен проводить тепло достаточно эффективно, чтобы поддерживать температуру перехода светодиодов в рекомендуемых производителем пределах. Эта задача становится еще более сложной, поскольку размеры светодиодов CSP уменьшаются, номинальная мощность увеличивается, а разработчик модуля упаковывает все больше и больше CSP в более плотные массивы — теперь MCPCB действительно должен работать за свои деньги.

Чтобы лучше понять масштаб этой проблемы, необходимо ее разбить.
Рисунок 1: Тепловая модель теплового потока, исходящего от CSP-светодиода 1×1 мм через субмонтаж из AlN 0,635 мм (170 Вт / мК) к радиатору, иллюстрирующая возникающее распространение, эффективно снижающее тепловое сопротивление пути.

Рисунок 2: Радиальное распространение тепла от точечного источника тепла в медном диске, размеры которого соответствуют большой площади медной проводки на MCPCB

Рис. 3: Упрощенная симуляция светодиода CSP на MCPCB, показывающая, что медная проводка диаметром 60 мкм не может распространять тепло вбок на любое значительное расстояние.Близкого сходства теплового потока с рисунком 1 следует ожидать, если в качестве подложки используется высокопроизводительный MCPCB, совокупная теплопроводность которого превышает 150 Вт / м · К

Рекомендации по расчетам

При расчете теплового потока в конструкциях CSP важен приоритет осевой проводимости:
Во-первых, стоит учесть, что в большинстве конструкций светодиодных плат CSP эффективность осевой теплопроводности имеет тенденцию играть более важную роль, чем эффективность поперечной теплопроводности. теплопроводность.В этом контексте осевая теплопроводность является осью z, то есть через толщину MCPCB, в то время как боковая или радиальная теплопроводность находится в плоскости по оси x / y и происходит преимущественно на трассе медной разводки MCPCB.

Чтобы проиллюстрировать это, рассмотрим стандартный светодиод CSP, припаянный к слою медной схемы толщиной около 50 мкм и диаметром 35 мм, который, в свою очередь, расположен на диэлектрике, а затем на алюминиевом теплораспределителе. В зависимости от марки платы теплопроводность диэлектрика обычно находится в диапазоне от 3 до 10 Вт / мК и от 10 до 50 мкм по толщине.Это означает, что осевое тепловое сопротивление будет находиться в диапазоне от 0,16 до 0,01 ° C ∙ см2 / Вт. То есть для диэлектрической плиты со стороной 10 мм каждый ватт теплопередачи не будет проходить мгновенно, а приведет к расчетной разнице температур (0,16–0,01 ° C) между двумя поверхностями.

Следующим шагом является проверка радиального термического сопротивления медного диска. Медь — отличный проводник тепла с теплопроводностью почти 400 Вт / мК. Но при толщине всего 50 мкм, что составляет половину толщины человеческого волоса, его способность передавать тепло по длине сильно ограничена.Если взять брусок из меди шириной 1 мм, толщиной 50 мкм и длиной 5 мм, то полное тепловое сопротивление будет более 250 ° C / Вт. Ясно, что это значительно по сравнению с осевым тепловым сопротивлением, поэтому, когда медный диск прикреплен к диэлектрическому слою с очень низким тепловым сопротивлением, большая часть тепла быстро уходит через диэлектрик и вниз к радиатору, и ни один из них не дойдет до край медного участка.

Это демонстрируется расширением предыдущего моделирования, чтобы включить слой меди толщиной 35 мкм, покрывающий все 3.Площадь 5×3,5 мм, но сохраняя размеры горячего светодиода CSP прежними. Модель показывает некоторое распространение тепла, происходящее в меди, но его степень ограничена увеличением площади радиатора на 15%.

На практике для оптимального охлаждения светодиодов CSP необходимо сбалансировать осевую и радиальную проводимость. Если площадь меди чрезмерно уменьшена, слишком много полагается на осевую проводимость, поэтому тепловое сопротивление возрастает. Это означает, что плотная упаковка светодиодов CSP может привести к тепловому дисбалансу по площади массива.И наоборот, чрезмерно большая площадь меди имеет мало преимуществ из-за ее высокого теплового сопротивления в плоскости, которое предотвращает распространение тепла на значительное расстояние.

Часто предполагается, что нанесение толстого слоя меди на MCPCB будет распространять тепло в разные стороны, уменьшая плотность потока и облегчая отвод тепла путем теплопроводности через диэлектрик с посредственным термическим сопротивлением. Хотя это в определенной степени верно, только самые лучшие MCPCB имеют достаточно низкое тепловое сопротивление, чтобы вмещать мощные светодиоды CSP.Для этих продуктов увеличение толщины меди не изменяет оптимальную площадь меди (диаметром около 3,5 мм), поскольку теплопроводность в плоскости даже для плоскости меди толщиной 105 мкм (3 унции) на MCPCB приличного качества все еще сохраняется. низкая по оси z проводимость диэлектрика. Также существует ограничение, заключающееся в том, что медные дорожки под светодиодами CSP должны иметь зазор около 200 мкм, и это становится все труднее по мере увеличения толщины меди.

При любом термическом анализе светодиодных структур необходимо помнить, что тепловой путь между светодиодом и радиатором не представляет собой сплошной кусок однородного материала. Обычно он состоит из сложного набора материалов, таких как корпус светодиода, паяное соединение, печатная плата, материал термоинтерфейса, теплоотвод и многое другое. Каждая из этих структур будет иметь совершенно разные размеры, теплопроводность и удельную теплоемкость с различным сопротивлением на границе раздела между всеми различными слоями.Из них сопротивление интерфейса часто является наиболее важным и одним из самых сложных для моделирования. Тепловое сопротивление одного интерфейса может затмить тепловые свойства других материалов в конструкции и бросить вызовы расчетам производительности. Лучшие технические решения направлены на минимизацию межфазного сопротивления между элементами на плате, и наиболее надежный способ сделать это — исключить их из конструкции. Покрытия и другие слоистые конструкции особенно уязвимы к высокому межфазному сопротивлению, которое может измениться со временем.Хотя лучше всего подходят однородные материалы, когда требуется сборка из разных материалов, наиболее надежным и надежным подходом является достижение связи между материалами на атомарном уровне. На этом основании работает только ограниченный диапазон процессов нанесения покрытий и осаждения.

Об идеальном профиле решения MCPCB для светодиодов CSP

Итак, повторюсь, высокая осевая проводимость через MCPCB является ключом к успешной конструкции CSP. Когда осевая проводимость высока, это сводит на нет преимущества по распределению тепла, обычно достигаемые при использовании толстой медной проводки.Для эффективного управления точечным тепловым потоком, создаваемым CSP, требуется другой подход к самому MCPCB.

Основываясь на наблюдениях за первичностью осей, описанных выше, мы знаем, что MCPCB необходимо минимизировать толщину своего самого слабого звена — диэлектрического слоя. Термическое сопротивление делится на толщину, деленную на теплопроводность. Теплопроводность присуща материалу, выбранному для диэлектрика, поэтому единственная доступная переменная — это толщина. Diamond идеально подходит для этого приложения, но слишком дорого.Диэлектрик не может быть слишком тонким, так как он должен поддерживать приемлемую электрическую изоляцию, чтобы обеспечить соответствие MCPCB соответствующим нормативам. Слой диэлектрика также должен быть достаточно прочным, чтобы выдерживать производственный процесс, и достаточно прочным, чтобы прослужить активную службу. И, наконец, стек MCPCB должен минимизировать межфазное сопротивление между различными материалами, чтобы максимизировать теплопроводность композита.

Рисунок 4: График, демонстрирующий, что для MCPCB с достаточно низким тепловым сопротивлением для размещения светодиодов CSP вес меди незначительно влияет на производительность

Альтернативные решения MCPCB для светодиодов CSP

Практически все MCPCB имеют один и тот же базовый формат с точки зрения их конструкции: они изготовлены из листа металла (обычно алюминия, иногда меди), покрытого тонким (30+ мкм) слоем меди для проводки.Этот медный лист прикреплен (и электрически изолирован от металлического основания) диэлектрическим слоем эпоксидной смолы, заполненным частицами теплопроводящей керамики для повышения тепловых характеристик. Однако существует верхний предел количества добавляемой теплопроводящей керамики. Перегрузите эпоксидную смолу керамикой, и диэлектрический слой станет рыхлым, и адгезия к металлической подложке и медным проводам будет плохой. Не подходит для продукта, который должен быть достаточно прочным, чтобы прослужить несколько десятилетий (50 000 часов) активной службы.

Несмотря на то, что эти теплопроводящие диэлектрики постоянно совершенствуются, всегда существует компромисс между характеристиками и долговечностью. На данный момент это ограничивает производительность MCPCB до композитной теплопроводности ниже 100 Вт / мК.

Эти тепловые характеристики вполне приемлемы для большинства конструкций светодиодных модулей, но когда дело доходит до модулей CSP, особенно для конструкций с высокой плотностью питания, они просто не обеспечивают требуемых характеристик. Исторически существовал только один вариант, доступный производителям, когда тепловые характеристики MCPCB не соответствовали требованиям, и это был переход на полностью керамическую подложку, такую ​​как нитрид алюминия; материал с исключительно высокой теплопроводностью и исключительно высокой ценой.

Нанокерамика сочетает в себе лучшие элементы керамических и металлических печатных плат, используя при этом первостепенное значение аксиальной проводимости и низкое сопротивление поверхности раздела для достижения оптимального эффекта.

Как работает нанокерамика как решение для MCPCB

Запатентованный процесс электрохимического окисления (ECO) преобразует поверхность листа алюминия в слой оксида алюминия (Al2O₃) толщиной всего в несколько десятков микрон. Хотя оксид алюминия не является особенно эффективным проводником тепла (около 7,3 Вт / мК для оксида алюминия, созданного в процессе ECO), тонкость слоя означает, что тепло имеет чрезвычайно короткий путь до алюминиевого основания.

Интересным побочным эффектом преобразования ECO является то, что слой оксида алюминия атомарно связан с алюминиевой основой. Это оказывает значительное влияние на сопротивление поверхности раздела между двумя материалами, помогая снизить общее тепловое сопротивление пакета. Прочность также впечатляет, и невозможно механически отделить нанокерамику от алюминия, из которого она была сформирована.

Эта комбинация очень тонкого диэлектрического слоя с относительно высокой теплопроводностью, атомарно связанного с алюминиевой основой, дает MCPCB, содержащему нанокерамику с ламинированной медью, исключительную общую теплопроводность около 115 Вт / мК (медная проводка прикреплена к нанокерамика с эпоксидным слоем 3-5 мкм).Это делает этот продукт идеально подходящим для приложений CSP.

Выводы

По мере того, как дизайнеры продолжают исследовать возможности светодиодов CSP, они регулярно обнаруживают, что их конструкции выходят за рамки возможностей стандартной технологии MCPCB. Этот тепловой предел ставит барьер на пути инноваций, и необходима новая технология, чтобы заполнить пробел между традиционными MCPCB и дорогой керамикой из нитрида алюминия. Нанокерамика — один из материалов, способных заполнить эту нишу.Предлагая тепловые характеристики, адаптированные к требованиям интенсивного точечного потока светодиодов CSP, наряду с технологичностью изготовления, MCPCB с нанокерамическим диэлектриком устраняет разрыв между традиционными MCPCB и керамикой, позволяя разработчикам светодиодов CSP раздвигать границы — создавая меньшие, более яркие и экономичные источники света.

Продукты Pro-MRI | Принадлежности и расходные материалы

Phantom для комплексная оценка критических параметров изображения магнитно-резонансной томографии (МРТ) с минимальными затратами времени.Фантом можно использовать для измерения абсолютных значений в целях калибровки . Однако его конструкция также оптимизирована для эффективного ежедневного контроля качества .

Может использоваться для измерения:

  • Геометрические искажения
  • Пространственное разрешение
  • Толщина и положение среза
  • Межсетевой зазор
  • T 1 и T 2 значения
  • Оценка ширины полосы изображения
  • Обнаружение низкой контрастности
  • Равномерность изображения
  • Отношение сигнал / шум (SNR)
  • Физическое и электронное смещение среза
  • Ориентир
  • Пропускная способность: водно-жировой сдвиг

Технические данные (могут быть изменены по желанию заказчика):

  • Внешний диаметр цилиндра: 220 мм (180 мм)
  • внешняя высота цилиндра: 150 мм
  • Внутренний диаметр цилиндра: 204 мм (173 мм)
  • внутренняя высота цилиндра: 130 мм
  • заполнен 10 ммоль раствором хлорида никеля, содержащим
  • натрия хлорид 75 ммоль
  • T 1 и T 2 виалы для образцов
    — 6 цилиндрических виал Ø19 x 41 мм
    — заполняемые снаружи
    — по умолчанию заполнены 20 ммоль хлорида никеля и 15 ммоль раствора хлорида натрия
  • разрешение вставки:
    — четыре матрицы отверстий, диаметры: 0.8, 0,9, 1,0 и 1,1 мм
    — промежутки между отверстиями равны диаметрам отверстий
    — две небольшие емкости с водой и жиром для оценки сдвига воды и жира
  • пластина толщины среза:
    — пластина из ПММА 180 x 46 x 10 мм
    — противонаправляющие щели шириной 1 мм и глубиной 5 мм с обеих сторон
    — щели образуют две наклонные плоскости, спускающиеся с геометрическим искажением 1:10 Вставка:
    — массив 10 x 10 квадраты
    — 148 мм со стороны
    — толщиной 10 мм
  • Низкоконтрастная вставка:
    — 4 диска из поликарбоната 0.05, 0,1, 0,15 и 0,2 мм толщиной
    — частичный вклад объема этих листов и раствора для заполнения создают контрасты: 1,4, 2,5, 3,6 и 5,1%
    — каждый диск содержит 12 групп по 3 отверстия, расположенных в спицах
    — каждая спица имеет тот же диаметр
    — диаметры от 7,0 до 1,5 мм (шаг 0,5 мм)
  • Четыре набора парных клиньев 45 ° расположены с обеих сторон фантома. Нижние пары имеют размер 30 x 30 мм, а верхние — 40 x 40 мм. Расстояние между точками пересечения нижней и верхней пар 90мм

Дополнительно:

  • 09-103 опционально 6 съемных виал для тестовых образцов — заменяет «T 1 и T 2 виалы для образцов», включает 6 дополнительных виал (всего 12)
  • 09-104 опциональный съемный 3-осевой уровень
  • 09-102 дополнительный чемодан для тяжелых условий эксплуатации

Характеристики продукта:

  • Соответствует:
    — Программа аккредитации МРТ ACR
    — Отчет 80 IPEM «Контроль качества МРТ», 1998 г.
    — Представитель AAPM.28 «Методы обеспечения качества и фантомы для МРТ», 1990 г.
    — Представитель AAPM 34 «Приемочные испытания систем МРТ», 1992 г.
    — Представитель AAPM 100 «Процедуры приемки и обеспечения качества для объектов МРТ», 2010 г.
  • Сертификат CE
  • Руководство содержит подробные инструкции по проведению каждого теста, оценке результатов и регистрации

% PDF-1.7 % 38 0 объект > эндобдж xref 38 86 0000000016 00000 н. 0000002399 00000 н. 0000002602 00000 н. 0000002644 00000 н. 0000002678 00000 н. 0000003330 00000 н. 0000003411 00000 н. 0000003548 00000 н. 0000003685 00000 н. 0000003822 00000 н. 0000003959 00000 н. 0000004096 00000 н. 0000004233 00000 н. 0000004370 00000 н. 0000004508 00000 н. 0000004646 00000 н. 0000004790 00000 н. 0000005185 00000 н. 0000005572 00000 н. 0000005655 00000 н. 0000006007 00000 н. 0000006474 00000 н. 0000006898 00000 н. 0000006933 00000 п. 0000007264 00000 н. 0000007375 00000 н. 0000007488 00000 н. 0000007898 00000 п. 0000008172 00000 п. 0000008701 00000 н. 0000008814 00000 н. 0000008957 00000 н. 0000008982 00000 п. 0000009610 00000 п. 0000010881 00000 п. 0000011047 00000 п. 0000011454 00000 п. 0000012504 00000 п. 0000013757 00000 п. 0000014963 00000 п. 0000015953 00000 п. 0000016912 00000 п. 0000017384 00000 п. 0000017914 00000 п. 0000018188 00000 п. 0000019202 00000 п. 0000020247 00000 п. 0000022896 00000 п. 0000022965 00000 п. 0000023086 00000 п. 0000066797 00000 п. 0000067084 00000 п. 0000067572 00000 п. 0000106733 00000 н. 0000109662 00000 н. 0000112185 00000 н. 0000112572 00000 н. 0000112959 00000 н. 0000141384 00000 н. 0000141468 00000 н. 0000141829 00000 н. 0000142096 00000 н. 0000142402 00000 н. 0000145354 00000 п. 0000145697 00000 н. 0000146130 00000 н. 0000146152 00000 н. 0000146174 00000 н. 0000146196 00000 п. 0000146218 00000 н. 0000146240 00000 н. 0000146262 00000 н. 0000146284 00000 н. 0000186808 00000 н. 0000190917 00000 н. 0000198121 00000 н. 0000198198 00000 н. 0000198275 00000 н. 0000198352 00000 н. 0000198429 00000 н. 0000198506 00000 н. 0000198583 00000 н. 0000198667 00000 н. 0000198751 00000 н. 0000198867 00000 н. 0000002016 00000 н. трейлер ] / Назад 276059 >> startxref 0 %% EOF 123 0 объект > поток hb«` (Ȁ

Пакет PDF (362 КБ)

DtSheet
    Загрузить

Пакет PDF (362 КБ)

Открыть как PDF
Похожие страницы
IC / LSI / датчики изображения PDF (534 КБ)
逐行 扫描 ПЗС-матрица (14)
Каталог продукции (март 2016 г.) PDF (4.4 МБ)
ETC AN32502A
ROHM BD6066GU
Устройства питания PDF (409 КБ)

dtsheet © 2021 г.

О нас DMCA / GDPR Злоупотребление здесь

Влияние CSP 310 и CSP 310-подобных белков из злаков на митохондриальную энергетическую активность и перекисное окисление липидов in vitro и in vivo

  • 1.

    Паркин К.Л., Марангони А., Джекман Р., Яда Р., Стэнли Д.: Переохлаждение. Обзор возможных механизмов. J. Food Biochem. 1989, 13: 127-153.

    CAS Статья Google Scholar

  • 2.

    Loubaresse M, Paulin A, Dereuddre J: Влияние замораживания на перекисное окисление мембранных липидов корней рододендрона (Rhododendron cv. Demontague, Jean-Marie). Compte. Ренду. Акад. Sci. 1991, 313: 453-459.

    CAS Google Scholar

  • 3.

    Shewfelt RL, Erickson ME: Роль перекисного окисления липидов в механизме мембран-ассоциированных нарушений в съедобных растительных тканях. Тенденции в пищевой науке. Technol. 1991, 2: 152-154. 10.1016 / 0924-2244 (91)

  • -2.

    CAS Статья Google Scholar

  • 4.

    Purvis AC, Shewfelt RL, Georgenie JW: Производство супероксида митохондриями, выделенными из плодов зеленого болгарского перца. Physiol. Завод. 1995, 94: 743-749. 10.1034 / j.1399-3054.1995.940429.x10.1034 / j.1399-3054.1995.940429.x.

    CAS Статья Google Scholar

  • 5.

    Рихтер Ч., Гогвадзе В., Лаффранки Р., Шлапбах Р. Окислители в митохондриях: от физиологии к болезням. BBA. 1995, 1271: 67-74. 10.1016 / 0925-4439 (95) 00012-С.

    PubMed Google Scholar

  • 6.

    Скулачев В.П .: Возможная роль активных форм кислорода в противовирусной защите.Биохимия (Москва). 1998, 63: 1691-1694.

    Google Scholar

  • 7.

    Tangeras A, Flatmark T, Bäcktröm D, Ehrenberg A: содержание митохондриального железа, не связанного с гемом и железосерными центрами. BBA. 1980, 589: 162-175.

    PubMed CAS Google Scholar

  • 8.

    Minotti G, Aust SD: Исследование механизма цитрат-Fe 2+ -зависимого перекисного окисления липидов.Свободный Радич. Биол. & Мед. 1987, 3: 379-387. 10.1016 / 0891-5849 (87)

    -5.

    CAS Статья Google Scholar

  • 9.

    Hausladen A, Alscher RG: Глутатион. В кн .: Антиоксиданты высших растений. (Под редакцией Alscher RG, Hess JL) Бока Ратон, CRC Press. 1993, 1-30.

    Google Scholar

  • 10.

    Скулачев В.П .: Снижение внутриклеточной концентрации O 2 как особая функция дыхательных систем клеток.Биохимия (Москва). 1994, 59: 1910-1912.

    CAS Google Scholar

  • 11.

    Коршунов С.С., Коркина О.В., Рууге Е.К., Скулачев В.П., Старков А.А.: Жирные кислоты как естественные разобщители, препятствующие образованию O 2 и H 2 O 2 митохондриями в покое. штат. FEBS Lett. 1999, 435: 215-218. 10.1016 / S0014-5793 (98) 01073-4.

    Артикул Google Scholar

  • 12.

    Kowaltowski AJ, Costa ADT, Vercesi AE: Активация растения картофеля, разобщающего митохондриальный белок, подавляет образование активных форм кислорода дыхательной цепью. FEBS Lett. 1999, 425: 213-216. 10.1016 / S0014-5793 (98) 00231-2.

    Артикул Google Scholar

  • 13.

    Vanlerberghe GC, McIntosh L: Более низкая температура выращивания увеличивает емкость альтернативных путей и альтернативный белок оксидазы в табаке. Plant Physiol.1992, 100: 115-119.

    PubMed CAS PubMed Central Статья Google Scholar

  • 14.

    Колесниченко А.В., Боровский Г.Б., Войников В.К., Мишарин С.И., Антипина А.И.: Накопление антигена озимой ржи при низких температурах. Russ J Plant Physiol. 1996, 43: 771-776.

    CAS Google Scholar

  • 15.

    Войников В., Побежимова Т., Колесниченко А., Варакина Н., Боровский Г. Стрессовый белок 310 кДа влияет на энергетическую активность митохондрий растений в условиях гипотермии.J Therm Biol. 1998, 23: 1-4. 10.1016 / S0306-4565 (97) 00036-3.

    CAS Статья Google Scholar

  • 16.

    Зыкова В.В., Грабельнич О.И., Антипина А.И., Королева Н.А., Владимирова С.В., Колесниченко А.В., Побежимова Т.П., Войников В.К .: Расцепляющий белок CSP 310, связанный со стрессом растений, вызывал перекисное окисление липидов в митохондриях озимой пшеницы в условиях холодового стресса. J Therm Biol. 2000, 25: 323-327. 10.1016 / S0306-4565 (99) 00099-6.

    PubMed CAS Статья Google Scholar

  • 17.

    Колесниченко А., Грабельнич О., Турчанинова В., Зыкова В., Королева Н., Побежимова Т., Войников В. Влияние стрессового белка CSP 310 и антисыворотки к этому белку на перекисное окисление липидов в митохондриях злаков. J Иммуноанализ и иммунохимия. 2001, 22: 113-126. 10.1081 / МСФО-100103224.

    CAS Статья Google Scholar

  • 18.

    Колесниченко А.В., Остроумова Е.А., Зыкова В.В., Войников В.К .: Сравнение белков с иммунохимическим сродством к стрессовому белку 310 кДа в цитоплазматических белках озимой ржи, озимой пшеницы, Elymus и кукурузы.J Therm Biol ,. 1999, 24: 211-215. 10.1016 / S0306-4565 (99) 00008-X.

    CAS Статья Google Scholar

  • 19.

    Колесниченко А., Зыкова В., Войников В. Сравнение иммунохимического сродства цитоплазматических, митохондриальных и ядерных белков озимой ржи ( Secale cereale l .) К стрессовому белку 310 кДа в контрольных растениях и во время воздействие холодового стресса. J Therm Biol. 2000, 25: 203-209. 10.1016 / S0306-4565 (99) 00023-6.

    CAS Статья Google Scholar

  • 20.

    Колесниченко А., Грабельнич О., Побежимова Т., Войников В.: Ассоциация растительного стрессорасцепляющего белка CSP 310 с митохондриями озимой пшеницы in vitro при воздействии низких температур. J. Plant Physiol. 2000, 156: 805-807.

    CAS Статья Google Scholar

  • 21.

    Дэви де Вирвиль Т., Аарон И., Алин М.Ф., Моро Ф .: Выделение и свойства митохондрий из суспензионных культур клеток Arabidopsis thaliana.Plant Physiol Biochem. 1994, 32: 159-166.

    CAS Google Scholar

  • 22.

    Толберт Н.Э .: Выделение субклеточных органелл метаболизма на изопикническом градиенте сахарозы. Методы в энзимологии. 1974, 31: 734-736.

    PubMed CAS Статья Google Scholar

  • 23.

    Лоури О.Н., Роузбро, штат Нью-Джерси, Фарр А.Л., Рэндалл Р.Дж.: Измерение белка с помощью фенольного реагента Folin.J Biol Chem. 1951, 193: 265-275.

    PubMed CAS Google Scholar

  • 24.

    Estabrook RW: Митохондриальный респираторный контроль и полярографические измерения отношения АДФ: О.

  • Добавить комментарий